PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.100440.2
Common NameCsa_7G033350, WRKY49
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family WRKY
Protein Properties Length: 434aa    MW: 47528.6 Da    PI: 6.0351
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.100440.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY932.2e-29112169260
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     +Dg+nWrKYGqK vkg+ f rsYYrCt+++C+vkk++er++ d+k+++++Y g+H+h+k
  Cucsa.100440.2 112 EDGFNWRKYGQKLVKGNVFVRSYYRCTHPTCMVKKQLERTH-DGKITDTVYFGQHDHPK 169
                     7***************************************9.***************85 PP

2WRKY106.51.4e-33285342158
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                     ++Dgy+WrKYGqK vkg+++prsYYrC+s+gCpvkk+ver+++dpk+v +tYeg+H+h
  Cucsa.100440.2 285 VNDGYRWRKYGQKFVKGNPNPRSYYRCSSPGCPVKKHVERASHDPKIVLTTYEGQHDH 342
                     58*******************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.7E-26100170IPR003657WRKY domain
PROSITE profilePS5081122.263106170IPR003657WRKY domain
SuperFamilySSF1182904.18E-24107170IPR003657WRKY domain
SMARTSM007741.6E-32111169IPR003657WRKY domain
PfamPF031068.8E-23112168IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.9E-35271344IPR003657WRKY domain
SuperFamilySSF1182906.93E-29277345IPR003657WRKY domain
PROSITE profilePS5081135.588280345IPR003657WRKY domain
SMARTSM007743.1E-38285344IPR003657WRKY domain
PfamPF031061.7E-26286342IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 434 aa     Download sequence    Send to blast
MVSTGDGDQL ENEVDSDQLD HENSSDSQPQ ASQDDPGGTN ASKSDHKCTG ASSNTLEEAV  60
KQPEVTIALV DRGEISSIVT EKVTHKPITA EQNPLSVLKV CITSSIREKV SEDGFNWRKY  120
GQKLVKGNVF VRSYYRCTHP TCMVKKQLER THDGKITDTV YFGQHDHPKP QPHIPVPVGV  180
VTMVEEKLGE HASGNSQDKT SIALSQTPQQ TELADMRQPP SVIASDNVKD EVSKRSRTND  240
EVDSDDTPDL KREKKRCNID VTTVADKSTV ESRVVVQTPS EVDIVNDGYR WRKYGQKFVK  300
GNPNPRSYYR CSSPGCPVKK HVERASHDPK IVLTTYEGQH DHVVPPIRTV TLNSVGSTTA  360
QSDETKPKPV STVVHASKDP RSDSSSEGKL IEENGKLNAT ETSDDIILDG VVVNPSPGVA  420
SEQNKQLKVA IES*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A6e-37110346175WRKY transcription factor 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00094SELEXTransfer from AT2G04880Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU9840340.0GU984034.1 Cucumis sativus WRKY protein (WRKY49) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001267610.10.0probable WRKY transcription factor 20-like
RefseqXP_011658539.10.0PREDICTED: probable WRKY transcription factor 20-like isoform X1
SwissprotQ9SI372e-86WRKY1_ARATH; WRKY transcription factor 1
TrEMBLE7CEY30.0E7CEY3_CUCSA; Uncharacterized protein
STRINGPOPTR_0014s16220.11e-104(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04880.24e-93zinc-dependent activator protein-1
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Ling J, et al.
    Genome-wide analysis of WRKY gene family in Cucumis sativus.
    BMC Genomics, 2011. 12: p. 471
    [PMID:21955985]
  4. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]